Scaffold metazooDRAFT_10832305

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold metazooDRAFT_10832305

Scaffold metazooDRAFT_10832305

Overview

Basic Information
Taxon OID	3300002476 Open in IMG/M
Scaffold ID	metazooDRAFT_10832305 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	661
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake → Freshwater Microbial Community From Sao Paulo Zoo Lake, Brazil

Source Dataset Sampling Location
Location Name	Sao Paulo, Brazil
Coordinates	Lat. (^o)	-23.651072	Long. (^o)	-46.620675	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024768	Metagenome / Metatranscriptome	204	Y

Sequences

Protein ID	Family	RBS	Sequence
metazooDRAFT_108323052	F024768	GGA	MNYETEIIDGRRAIVRHFFKAHEIQVGSRWARADGSKGYVTVEGFNTYGTTNPWIEVVYSWELNGEKFIHEKDVFIFQSKYCLIVGD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.