Scaffold metazooDRAFT_1410216

Overview

Basic Information

• Taxon OID: 3300002471
• Scaffold ID: metazooDRAFT_1410216
• Source Dataset Name: Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 509
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake → Freshwater Microbial Community From Sao Paulo Zoo Lake, Brazil

Source Dataset Sampling Location

• Location Name: Sao Paulo, Brazil
• Coordinates
  • Lat. (^o): -23.651072
  • Long. (^o): -46.620675

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025941	Metagenome / Metatranscriptome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
metazooDRAFT_14102161	F025941	N/A	PIIWGETGATGPTVTHKLSVDALANGSARQGDYADLGADWDDEYNVYLFVETGTAPTAGTTVEAYLVSTWDKSYWPGKVTGSDGAYTLGTSDANLRQVGTPVVTLVATTDADTVLGQAPSIWRPRGRYVAPIIDNNLGQAFRDEATATNNGTRLIIVHRRLIIND*