Scaffold LO132_10076948

Overview

Basic Information

• Taxon OID: 3300002465
• Scaffold ID: LO132_10076948
• Source Dataset Name: Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Pennsylvania State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1261
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon RBG_16_50_20 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake → Freshwater Lake Biofilm Microbial Communities From Frasassi Caves, Italy In Anoxic Conditions

Source Dataset Sampling Location

• Location Name: Frasassi Caves, Italy
• Coordinates
  • Lat. (^o): 43.3833
  • Long. (^o): 12.95

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074280	Metagenome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
LO132_100769482	F074280	AGG	MELGVSQRETERGLRAVEWSLSYLTIGGLSFLVAIVLERLVMGLEGYLLTTEIYSLHGFSHIFFGIGLASIILFLRPRSSARVVILGVLLAGIAWELQEGYWLRGEMIDSVEDVVLAILSASTFLCFTRMNDREGAARFPKEP*