NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LO132_10054657

Scaffold LO132_10054657


Overview

Basic Information
Taxon OID3300002465 Open in IMG/M
Scaffold IDLO132_10054657 Open in IMG/M
Source Dataset NameAnoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterPennsylvania State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1585
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon RBG_13_38_9(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake → Freshwater Lake Biofilm Microbial Communities From Frasassi Caves, Italy In Anoxic Conditions

Source Dataset Sampling Location
Location NameFrasassi Caves, Italy
CoordinatesLat. (o)43.3833Long. (o)12.95Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074280Metagenome119Y

Sequences

Protein IDFamilyRBSSequence
LO132_100546571F074280N/AVVIVLERLTRGFAGSMLRTEIYGIHGFSHVFFGIGLASIILFLRPKSTLRVVTLGVLVAGIAWELYEGYWLMGEPIDSLEDVVLVILSALAFLCFIRRRDAERAG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.