Scaffold JGI24702J35022_10289351

Overview

Basic Information

• Taxon OID: 3300002462
• Scaffold ID: JGI24702J35022_10289351
• Source Dataset Name: Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 964
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Proctodeal Segment → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: Pointe-Noire, Republic of the Congo
• Coordinates
  • Lat. (^o): -4.7
  • Long. (^o): 11.83

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103489	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24702J35022_102893511	F103489	AGG	MGLWSTQAKVEGIVPKAAGHWGRDCSVLKDPPGKPSLTPLYIGLPSRWGSVDGDQMFSPFFV