Scaffold JGI24702J35022_10147088

Overview

Basic Information

• Taxon OID: 3300002462
• Scaffold ID: JGI24702J35022_10147088
• Source Dataset Name: Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1319
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Proctodeal Segment → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: Pointe-Noire, Republic of the Congo
• Coordinates
  • Lat. (^o): -4.7
  • Long. (^o): 11.83

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005211	Metagenome	408	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24702J35022_101470882	F005211	AGG	VNNDRTLKKIFNIKPDGARSVGRPKLRWEDGVDQGMRILGIKNWKKVALNRDEWAKLLKKARAHQRLSSQ*