Scaffold AADWTP_10030597

Overview

Basic Information

• Taxon OID: 3300002461
• Scaffold ID: AADWTP_10030597
• Source Dataset Name: Freshwater microbial communities from a drinking water treatment plant in Ann Arbor, Michigan, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4407
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (37.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Freshwater → Freshwater Microbial Communities From A Drinking Water Treatment Plant In Ann Arbor, Michigan, Usa

Source Dataset Sampling Location

• Location Name: Ann Arbor, Michigan, USA
• Coordinates
  • Lat. (^o): 42.296774
  • Long. (^o): -83.762994

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080249	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
AADWTP_100305977	F080249	AGGA	MADDKKNIGKPDRNLISFKEKYEFNYAAKQLQNQVADTTRQEAKDALTAAAKKVSPSEGREKIMRAARKILRD*