NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold AADWTP_10003507

Scaffold AADWTP_10003507


Overview

Basic Information
Taxon OID3300002461 Open in IMG/M
Scaffold IDAADWTP_10003507 Open in IMG/M
Source Dataset NameFreshwater microbial communities from a drinking water treatment plant in Ann Arbor, Michigan, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)66347
Total Scaffold Genes77 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)35 (45.45%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Freshwater → Freshwater Microbial Communities From A Drinking Water Treatment Plant In Ann Arbor, Michigan, Usa

Source Dataset Sampling Location
Location NameAnn Arbor, Michigan, USA
CoordinatesLat. (o)42.296774Long. (o)-83.762994Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019483Metagenome / Metatranscriptome229Y
F083928Metagenome112Y

Sequences

Protein IDFamilyRBSSequence
AADWTP_1000350757F019483N/AMSVTNPVPGATYGVTTIDFGTTPGSNEVFVNVTGQTGIKATSKVFAFIMADDTSVDHTANDHRFFGIFANLTCGTPTAGVGFTIYAKSFEKLTGNWTVRYF*
AADWTP_1000350775F083928N/AMNILTYFAGLRPAIPFSAEQGCKDMSNGELRRHIQNGSVLINHERVTVQEQIDFPVFSVVFFPNSVKRKTTLV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.