NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold NAPDCCLC_10092073

Scaffold NAPDCCLC_10092073


Overview

Basic Information
Taxon OID3300002446 Open in IMG/M
Scaffold IDNAPDCCLC_10092073 Open in IMG/M
Source Dataset NameOil sands microbial community from Northern Alberta which degrade Naphthaline
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1556
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameSyncrude tailings pond, Wood Buffalo, Alberta, Canada
CoordinatesLat. (o)57.02Long. (o)-111.55Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095532Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
NAPDCCLC_100920732F095532AGGMNRKNVIVVIAPTLEVWGNLKKLCEAKGFNILPYHSLKSKPFPIIHNEWIIHKVPFL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.