NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold NAPDCCLC_10006929

Scaffold NAPDCCLC_10006929


Overview

Basic Information
Taxon OID3300002446 Open in IMG/M
Scaffold IDNAPDCCLC_10006929 Open in IMG/M
Source Dataset NameOil sands microbial community from Northern Alberta which degrade Naphthaline
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8308
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameSyncrude tailings pond, Wood Buffalo, Alberta, Canada
CoordinatesLat. (o)57.02Long. (o)-111.55Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020377Metagenome224Y

Sequences

Protein IDFamilyRBSSequence
NAPDCCLC_100069292F020377GAGGMGLSRWWRERHFEREYRRSVKRDLARIGKEYEAKFKTLQTGNDFDASMAAYLKECRLPDLRLETLRSRRLRSRADAGGIDLPREWWEHDEEHDLWYLTPDGRRQLKRRLTQERLWAVKQWFQVLTPVAALAAGLVGVIIGLLAMWRWP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.