Scaffold NAPDCCLC_10001656

Overview

Basic Information

• Taxon OID: 3300002446
• Scaffold ID: NAPDCCLC_10001656
• Source Dataset Name: Oil sands microbial community from Northern Alberta which degrade Naphthaline
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 37633
• Total Scaffold Genes: 36
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 33 (91.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location

• Location Name: Syncrude tailings pond, Wood Buffalo, Alberta, Canada
• Coordinates
  • Lat. (^o): 57.02
  • Long. (^o): -111.55

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033858	Metagenome / Metatranscriptome	176	N

Sequences

Protein ID	Family	RBS	Sequence
NAPDCCLC_100016566	F033858	AGG	MSGAGTAKKIESLRKLRLSATMLEVGFKSENLGEIIQCQIELEELAARLRAEQGDLVTPEQCEAAKESLEAFVALVDQAMEKAAHNEGITPGQARPKPTTLGK*