Scaffold B570J29631_100125

Overview

Basic Information

• Taxon OID: 3300002370
• Scaffold ID: B570J29631_100125
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3799
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.098333
  • Long. (^o): -89.405278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044498	Metagenome	154	N

Sequences

Protein ID	Family	RBS	Sequence
B570J29631_1001255	F044498	AGGA	MQTDLNKFSYVANNERVLLLSRYSTNCSLTELLELQSPMAEIESETVPILSFLNGAIQRPLSYEQHIMNQKLMCAKKKFEKSCLLAYRVYCDMELKHNLLVKQYCNDEMILCSKAHDHHGYHCKLSNENHSTFEYDVKKTCETNIVFDGLHDLRCIMAPDYYPDGSHYIFPTPILSCLDSVNEEDVRLLLSLRH*