Scaffold JGIcombinedJ26865_1047321

Overview

Basic Information

• Taxon OID: 3300002347
• Scaffold ID: JGIcombinedJ26865_1047321
• Source Dataset Name: Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 682
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location

• Location Name: Barrow Environmental Observatory site, Barrow, Alaska
• Coordinates
  • Lat. (^o): 71.2999
  • Long. (^o): -156.61

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060986	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
JGIcombinedJ26865_10473212	F060986	AGGAG	LPDFDLGALGWNAALAEHLAAEQHDPDLVPGRVTAAHRAAYDVQTEHDLVRTRLPGRLLHENAD