Scaffold JGI20171J29575_11714685

Overview

Basic Information

• Taxon OID: 3300002308
• Scaffold ID: JGI20171J29575_11714685
• Source Dataset Name: Nasutitermes corniger P4 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 563
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Osteoglossocephalai → Clupeocephala → Euteleosteomorpha → Neoteleostei → Eurypterygia → Ctenosquamata → Acanthomorphata → Euacanthomorphacea → Percomorphaceae → Ovalentaria → Cichlomorphae → Cichliformes → Cichlidae → New World cichlids → Cichlasomatinae → Heroini → Amphilophus → Amphilophus citrinellus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: laboratory colony in Florida, USA
• Coordinates
  • Lat. (^o): 26.0625
  • Long. (^o): -80.2332

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031291	Metagenome	183	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20171J29575_117146852	F031291	N/A	AKFLPRLLTGAQKENRVTVSQELFDRSNAPLLSRFGPCGLFLVSEFEILTKRLSISDGRDRRKFDTGPSRHPAKHVPGRVPELEKTLGAVYQEWRGVL*