Basic Information | |
---|---|
Taxon OID | 3300002307 Open in IMG/M |
Scaffold ID | JGI24890J29729_1011518 Open in IMG/M |
Source Dataset Name | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2412 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Brandenburg, Germany | |||||||
Coordinates | Lat. (o) | 53.1666 | Long. (o) | 13.0333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F018308 | Metagenome | 235 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI24890J29729_10115185 | F018308 | N/A | SKRQGSGIRKEGGDEFKASPTRGRITQEFLLRQNDRHEEEVDFRKDGTRSKQQD* |
⦗Top⦘ |