Scaffold JGI24890J29729_1000513

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24890J29729_1000513

Scaffold JGI24890J29729_1000513

Overview

Basic Information
Taxon OID	3300002307 Open in IMG/M
Scaffold ID	JGI24890J29729_1000513 Open in IMG/M
Source Dataset Name	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	23566
Total Scaffold Genes	37 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	30 (81.08%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany

Source Dataset Sampling Location
Location Name	Brandenburg, Germany
Coordinates	Lat. (^o)	53.1666	Long. (^o)	13.0333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076796	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24890J29729_10005133	F076796	N/A	MKEKILDHLLKQVDAKVRVLEESLGTGEAKDYADYQRVCGTITGLLSVRMYITDLKKNLENFDE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.