NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J29644_1001404

Scaffold B570J29644_1001404


Overview

Basic Information
Taxon OID3300002303 Open in IMG/M
Scaffold IDB570J29644_1001404 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1988
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000450Metagenome / Metatranscriptome1126Y
F003422Metagenome / Metatranscriptome487Y

Sequences

Protein IDFamilyRBSSequence
B570J29644_10014041F000450AGGCGGMGXRANFGFVQPNGNTIVLYGHWAGHNMLAQLAEAVFKARPRWSDPSYATRITISQMINNDWGSETGWGLHVNEIGDNEHKIAIVDFNQQTFSLHEEAPRNDLDNKVNGMXNEAIFTMDLSNFVEKYADVTLSV*
B570J29644_10014045F003422N/ANELVSXKYTFVCDPDECDSLIELTSSDGFGFPSGVTELTCPCGRKTTLVSVEHATIQPTETEGNKMEETSTVTVPDTYNPNLLVTYKVIRGYSDAEYATDKVVNLEWELHNGRERQKQNSLLHSQIDSVKEIIAEAYADSQDQDTLRAIAEALQIEITKTIEFTATVEVTGTIDIDLLSEWGGDFDSEIEENLYVESQAGNIEINEQYVTNVREA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.