Scaffold JGIcombinedJ26739_100054821

Overview

Basic Information

• Taxon OID: 3300002245
• Scaffold ID: JGIcombinedJ26739_100054821
• Source Dataset Name: Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3637
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location

• Location Name: Algoma, Ontario, Canada
• Coordinates
  • Lat. (^o): 46.42
  • Long. (^o): -83.37

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062117	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
JGIcombinedJ26739_1000548216	F062117	N/A	QVHYISLSVGDQTYNVDTYYPNQPDWTLEEIDVAFQMDGNFKQEPYNVWLDQVNLTAY*