Scaffold KVWGV2_10328132

Overview

Basic Information

• Taxon OID: 3300002242
• Scaffold ID: KVWGV2_10328132
• Source Dataset Name: Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10276
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (69.23%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Hellenic Volcanic Arc

Source Dataset Sampling Location

• Location Name: Kolumbo Volcano, Greece
• Coordinates
  • Lat. (^o): 36.5
  • Long. (^o): 25.45
  • Depth (m): 494

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016620	Metagenome / Metatranscriptome	246	Y

Sequences

Protein ID	Family	RBS	Sequence
KVWGV2_103281327	F016620	AGAAG	VLRKITKALLLKEVIRVDPSASIQALYDIVTSIRTTNKRDTNRVSLAKEHLRSIKGHVRSLNERVQSLEEELKLLNEEK*