Basic Information | |
---|---|
Taxon OID | 3300002238 Open in IMG/M |
Scaffold ID | JGI20169J29049_10666517 Open in IMG/M |
Source Dataset Name | Nasutitermes corniger P1 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 585 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | laboratory colony in Florida, USA | |||||||
Coordinates | Lat. (o) | 26.0625 | Long. (o) | -80.2332 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001390 | Metagenome | 708 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI20169J29049_106665171 | F001390 | N/A | VLVFEQRHFYAFIMRLTVEERVFILESYLKTIPYAHCRQSFFEKIRILKINISRAIEEVNERTLRKVAENMVKRLDKCIEMDFISST* |
⦗Top⦘ |