Scaffold KVRMV2_100486900

Overview

Basic Information

• Taxon OID: 3300002231
• Scaffold ID: KVRMV2_100486900
• Source Dataset Name: Marine sediment microbial communities from Santorini caldera mats, Greece - red mat
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2980
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Hellenic Volcanic Arc

Source Dataset Sampling Location

• Location Name: Santorini caldera, Greece
• Coordinates
  • Lat. (^o): 36.5
  • Long. (^o): 25.45
  • Depth (m): 336

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052023	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
KVRMV2_1004869002	F052023	AGGGGG	MQQRKMLDIPVGTTVRSSNRAPIDGDYEFVEHIASSTCKPSGAESSIYLLRGELLPPCKSCGKRGIWKLTGSKFEISPEKDQTPYVLKEIRGDRPDVPYPSGTKK*