Scaffold KVRMV2_100062213

Overview

Basic Information

• Taxon OID: 3300002231
• Scaffold ID: KVRMV2_100062213
• Source Dataset Name: Marine sediment microbial communities from Santorini caldera mats, Greece - red mat
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2599
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Hellenic Volcanic Arc

Source Dataset Sampling Location

• Location Name: Santorini caldera, Greece
• Coordinates
  • Lat. (^o): 36.5
  • Long. (^o): 25.45
  • Depth (m): 336

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019151	Metagenome	231	Y

Sequences

Protein ID	Family	RBS	Sequence
KVRMV2_1000622132	F019151	N/A	MITANERAQDGLELFEINGTQSFEMTNDTLKICADDDGTIWRSVRGLDVLDADGNCVFSLSWSETGVCGTLHNEDFKVKITEEF*