Scaffold S2T7FKBa104N_1539802

Overview

Basic Information

• Taxon OID: 3300002228
• Scaffold ID: S2T7FKBa104N_1539802
• Source Dataset Name: Marine microbial communities from the Baltic Sea - S2t7 FKBa (104N)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Karolinska Institutet
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 15274
• Total Scaffold Genes: 21
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (9.52%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 57.305
  • Long. (^o): 20.0745
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104759	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
S2T7FKBa104N_153980211	F104759	N/A	MACKFLEDSKGNKSSKRLWGSILLSIGIAFSSILFFYSLKAGAKDAATALGIINMFLISGGGLLGIGVFEKAINKIDEDK*