Scaffold M1t6FKB1101N_1740280

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold M1t6FKB1101N_1740280

Scaffold M1t6FKB1101N_1740280

Overview

Basic Information
Taxon OID	3300002227 Open in IMG/M
Scaffold ID	M1t6FKB1101N_1740280 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Baltic Sea - M1t6 FKB1 (101N)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Karolinska Institutet
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	20150
Total Scaffold Genes	26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (11.54%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	58.133	Long. (^o)	10.0	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009146	Metagenome / Metatranscriptome	322	Y

Sequences

Protein ID	Family	RBS	Sequence
M1t6FKB1101N_174028026	F009146	N/A	MAHKALFERVKNKLNETVNAAFIRSTKTEKGNTQISERVVIEKIREVLSSLELTFEEAGSQQSKDFRNVGGIGLNIEIKKTDNPVIYFNDTCPSKDIYYVVFFTGKEYKRTPEKNIQPTLLYINGEEFIKDSPWIAEYIAELTALKDKYARGENKKRLAGIMEVYPRPTFKANI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.