Scaffold M1t6FKB1101N_1576234

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold M1t6FKB1101N_1576234

Scaffold M1t6FKB1101N_1576234

Overview

Basic Information
Taxon OID	3300002227 Open in IMG/M
Scaffold ID	M1t6FKB1101N_1576234 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Baltic Sea - M1t6 FKB1 (101N)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Karolinska Institutet
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	586
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	58.133	Long. (^o)	10.0	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034571	Metagenome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
M1t6FKB1101N_15762343	F034571	N/A	YMQEGMSDEDAIQKAESEYHGQVNLVEDQALKINKRQVAFQKALRQGCYPSEIVLAMVVDHLQASYNSDSESTVVKEFCRELLTKINDDTLEVANAE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.