Basic Information | |
---|---|
Taxon OID | 3300002226 Open in IMG/M |
Scaffold ID | M1t6FKB2_1642420 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Baltic Sea - M1t6 FKB2 (106N) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Karolinska Institutet |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1670 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea Examining Degradability Of Arctic, Terrigenous Carbon Compounds In The Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltic Sea | |||||||
Coordinates | Lat. (o) | 58.133 | Long. (o) | 10.0 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004866 | Metagenome | 420 | Y |
F005243 | Metagenome / Metatranscriptome | 407 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
M1t6FKB2_16424201 | F004866 | GAG | MAIVNKVDLKHQVDINVSIKYQIVTYCFFNDTLISNSDLKFLTELAKEKGIELTKFCNKTVNEDIFKSAQSARNAITKAEKKGLLVKTGHNKKTIKLNPDINVQSNGLVLLDYKILGRESEKS* |
M1t6FKB2_16424203 | F005243 | N/A | VFINFKKHMMTDFKTNENLQDKDPKMSKEEMAARRDEITTFYKDNIPHLEVQADYETLLAAIEKARAERMQAQMFMAQQYAAQKGEGTPDPESPEGKAFQDAMAKAMTNETA* |
⦗Top⦘ |