Scaffold JGI24817J26689_1030526

Overview

Basic Information

• Taxon OID: 3300002221
• Scaffold ID: JGI24817J26689_1030526
• Source Dataset Name: Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_300m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 993
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 8.0
  • Long. (^o): -156.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012162	Metagenome / Metatranscriptome	283	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24817J26689_10305262	F012162	AGGAG	MLLTEEQTKQYLNDMIEHYEEKESNTTGVLSWQRSEAEYRRKTFEDMRIVLFGDDNNGYKRAKST*