Scaffold MLSBCLC_10067329

Overview

Basic Information

• Taxon OID: 3300002220
• Scaffold ID: MLSBCLC_10067329
• Source Dataset Name: Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 15117
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location

• Location Name: Syncrude, Ft. McMurray, Alberta
• Coordinates
  • Lat. (^o): 57.02
  • Long. (^o): -111.55

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058258	Metagenome	135	N

Sequences

Protein ID	Family	RBS	Sequence
MLSBCLC_1006732913	F058258	AGGAGG	VRKIVILAFAALMAGCSSXXXXXXXXXXXLVPEVSEKVELLLHNPQTRGLIAVRGGSLYLSYESALTFQERLTEMIEPVLDVDWALLVRDVPESRGSYRLGHWDASGLQWQERSGSSPLDGIRHTSMGYYYPLNGETCYVTFYLFSEPDTFDRNVKVLQRMAGTFSSGEVFTSRGYGW*