Basic Information | |
---|---|
Taxon OID | 3300002203 Open in IMG/M |
Scaffold ID | metazooDRAFT_1297671 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAR 2013 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 636 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake → Freshwater Microbial Community From Sao Paulo Zoo Lake, Brazil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sao Paulo, Brazil | |||||||
Coordinates | Lat. (o) | -23.651072 | Long. (o) | -46.620675 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002370 | Metagenome / Metatranscriptome | 566 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
metazooDRAFT_12976711 | F002370 | AGGAG | MDAKKAVHKHEKAMHPGKPLTKFAKGGKTNLQMRELGRNLAKVANQKKSSFT |
⦗Top⦘ |