Scaffold metazooDRAFT_1208488

Overview

Basic Information

• Taxon OID: 3300002195
• Scaffold ID: metazooDRAFT_1208488
• Source Dataset Name: Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 534
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake → Freshwater Microbial Community From Sao Paulo Zoo Lake, Brazil

Source Dataset Sampling Location

• Location Name: Sao Paulo, Brazil
• Coordinates
  • Lat. (^o): -23.651072
  • Long. (^o): -46.620675

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002045	Metagenome / Metatranscriptome	599	Y

Sequences

Protein ID	Family	RBS	Sequence
metazooDRAFT_12084881	F002045	N/A	MNFFCVYVKSRKKLDKYIKVNRIRNKYIIDIKKIIEDEEISIENGEVTYLKILIFQRIQQATEKNKDIYYIPDFESNFSIEKLLNIKKILKEEDNFNVLIFYNEFKKDSSIIDELMNNLTKFSASQIIRDY*