Scaffold JGI24770J26754_10000033

Overview

Basic Information

• Taxon OID: 3300002184
• Scaffold ID: JGI24770J26754_10000033
• Source Dataset Name: Freshwater and sediment microbial communities from Lake Erie, Canada
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 79728
• Total Scaffold Genes: 74
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 11 (14.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: Lake Erie, Canada
• Coordinates
  • Lat. (^o): 42.285437
  • Long. (^o): -81.355591

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034611	Metagenome / Metatranscriptome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24770J26754_100000338	F034611	N/A	MLPSKTVLSLTIDLLAHNAFNHLKDEEISALHHLILKLQEPLTAMQQNLLLTFWNHAYTGDLPASLLYRCNALLHQLGRSPLEEVMMEMEMY*