NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24145J26757_10057426

Scaffold JGI24145J26757_10057426


Overview

Basic Information
Taxon OID3300002183 Open in IMG/M
Scaffold IDJGI24145J26757_10057426 Open in IMG/M
Source Dataset NameArctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)888
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location NameBarrow, Alaska, USA
CoordinatesLat. (o)71.270939Long. (o)-156.810374Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004441Metagenome / Metatranscriptome438Y

Sequences

Protein IDFamilyRBSSequence
JGI24145J26757_100574262F004441GAGMHSQPGLRAAGFLVTFILLPFLPADAATPIKIDTKNLLVTVDAAACRWSAEVKGTPMRLNNVYFLPGDDHSGWTVTPSVNNNDSNNLGSFSTVTLRGRKPGQLDFEYQISVSKTNTDILVSLGRTNKTGKAVDVDDMDYFVSRDVRLGSTNDRWIALGTHSRNRDLYELAAVVNLITPKTYAVNHVVRDSDTGNA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.