Scaffold JGI24141J26756_1059422

Overview

Basic Information

• Taxon OID: 3300002179
• Scaffold ID: JGI24141J26756_1059422
• Source Dataset Name: Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 880
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location

• Location Name: Barrow, Alaska, USA
• Coordinates
  • Lat. (^o): 71.270939
  • Long. (^o): -156.810374

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051098	Metagenome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24141J26756_10594223	F051098	N/A	RFYKIGRSRMIIVPFYYCRNCKKLYPGSKLEIPNSPLEKLVPAARYTLGSQDHVFRIAGKTIQLSDLHQCNNHEVGLANFIKLQVEKEDHKG*