Basic Information | |
---|---|
Taxon OID | 3300002164 Open in IMG/M |
Scaffold ID | JGI24708J26588_10046727 Open in IMG/M |
Source Dataset Name | Biogas fermentation microbial communities from Germany - Plant 1 DNA2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1647 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bielefeld, North Rhine-Westphalia, Germany | |||||||
Coordinates | Lat. (o) | 52.0385 | Long. (o) | 8.4956 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F014003 | Metagenome / Metatranscriptome | 266 | Y |
F022612 | Metagenome / Metatranscriptome | 213 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI24708J26588_100467271 | F022612 | N/A | IRKDVARRLFKEGKTIYLTPSNVAASDSNMWIKPCAISNRSERDFDDIVNNYEFYNCCYELGYYTNFWINEEEE* |
JGI24708J26588_100467274 | F014003 | AGGAGG | MQTVFNKAKVKSWIKKAYKNSLFGYGHGYITDGYAMLMDEPHMHPTILEVFGTLTPECKHSAEQFKRLMRLPNKPIEVIDSKLEFILEPKRQLRILYDPKTGKELAVNSMYFNLLNNPEACTFHTNELMSMLWIVYDNETVGVIAPY |
⦗Top⦘ |