NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24707J26582_10012826

Scaffold JGI24707J26582_10012826


Overview

Basic Information
Taxon OID3300002163 Open in IMG/M
Scaffold IDJGI24707J26582_10012826 Open in IMG/M
Source Dataset NameBiogas fermentation microbial communities from Germany - Plant 1 DNA1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4578
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location
Location NameBielefeld, North Rhine-Westphalia, Germany
CoordinatesLat. (o)52.0385Long. (o)8.4956Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014003Metagenome / Metatranscriptome266Y
F014634Metagenome / Metatranscriptome261Y
F022612Metagenome / Metatranscriptome213Y
F048731Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
JGI24707J26582_100128265F014634AGGAGMQQRIKQVFDLERMKKFVEKNIDDTEWIEEEYGETRKILLIETLVHGGHGVYIPGMVLELFGQAEGYDLKNPYNYEKNESIHEDLMYWENKINDCLNELLPSKGYYYVGYLEHDGSYCLFYEEYEGETEQV*
JGI24707J26582_100128266F022612GGAGGMREILAYSDQYTRVRKDVARRLYKEGRTIYLTPSNVAASDSNMWIKPYPINNQRGLKSFDAIVNEFEYYNCNYELGYYTNFWINTEEK*
JGI24707J26582_100128267F048731AGGAGGVIKKALRYALAISEDPKEIKKNVEEYLAAAGYDRRYKFKWKALSGNAKYTFSGIFEFAGQRYYFSKHSGKLELERI*
JGI24707J26582_100128268F014003AGGAGGMNTVFNKTKVKSWIKKARKSPSFGYGHGYITDGYILLIEEQHMRPTILEVYGTLTPECKYSIEQFQKLLNLPDTPIEVIDSELEYAPKPKYRLRIFYDPKTGKELTIDGKYFDLLDTPRAHKFCTNDSMDRLWIKYYNDDVVGVIAPVMLQEQLSHIRFKAEEEREQV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.