Basic Information | |
---|---|
Taxon OID | 3300002161 Open in IMG/M |
Scaffold ID | JGI24766J26685_10042176 Open in IMG/M |
Source Dataset Name | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1049 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sandusky Bay, Ohio, USA | |||||||
Coordinates | Lat. (o) | 41.474889 | Long. (o) | -82.854137 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000557 | Metagenome / Metatranscriptome | 1026 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI24766J26685_100421761 | F000557 | N/A | MKLQDLTIDQFQRIAALEFSPVLTDYDKRAGVVAIVEGVDVSLVREMPAKGLTKRYKTIIAEWNELPTLAYRRRFEAGGKWWIPTVFTDELTAGQLIDLMDTDTTDEKKLVQNLHRIMATLCREGGLLGWFPKKYDGASHQERAELLKANAKI |
⦗Top⦘ |