NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24540J26637_10037370

Scaffold JGI24540J26637_10037370


Overview

Basic Information
Taxon OID3300002153 Open in IMG/M
Scaffold IDJGI24540J26637_10037370 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1732
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameNorwegian Sea, Atlantic Ocean
CoordinatesLat. (o)73.0188Long. (o)9.8566Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092703Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
JGI24540J26637_100373703F092703N/AMKKIIIFLLLLPIVSCSDFWWASSDATNYLILQVENYNSEFSVVKLSIINNEFEDLNIISGEFQDFELTNQVTGDLSDINILVDVDCISQGQITLSTQLDFSNGTAIIRIIDSNYDADVIMNCEDAAIWGL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.