Scaffold JGI24794J26673_10027746

Overview

Basic Information

• Taxon OID: 3300002151
• Scaffold ID: JGI24794J26673_10027746
• Source Dataset Name: Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by proteinase K digestion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1464
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea

Source Dataset Sampling Location

• Location Name: Gulf of Piran, Adriatic Sea
• Coordinates
  • Lat. (^o): 45.5099
  • Long. (^o): 13.56
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017881	Metagenome / Metatranscriptome	238	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24794J26673_100277461	F017881	GGAGG	MALFFHSQDVDELVPFPEAVSITENALRRIGTPEGVNAPRKRLNLHRTVAEAPFDTVLNIYAGGSSSYGAVGAQVALHRKAIVGDQQRRPPYNPDQTELALVYDADTGTLLGIMAHRPKH