NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold S2t7BSb_10907357

Scaffold S2t7BSb_10907357


Overview

Basic Information
Taxon OID3300002145 Open in IMG/M
Scaffold IDS2t7BSb_10907357 Open in IMG/M
Source Dataset NameS2t7BSb (114f)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)35358
Total Scaffold Genes41 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (14.63%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)57.305Long. (o)20.0745Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002643Metagenome / Metatranscriptome540Y

Sequences

Protein IDFamilyRBSSequence
S2t7BSb_1090735717F002643N/AMKYKDLNILVASINAVIGGQETKIQKKLFKLYEKVKPFHEEYNKQRDELRLDNAATDDKNILLTDEKGEYKFNKDGVKKLTKDFEALNEKEFEFKPIEVINTNGLEKFTFLKDWTTGIEFVDEEEEEL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.