NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold M2t2BS2_10371663

Scaffold M2t2BS2_10371663


Overview

Basic Information
Taxon OID3300002144 Open in IMG/M
Scaffold IDM2t2BS2_10371663 Open in IMG/M
Source Dataset NameMarine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1600
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)57.305Long. (o)20.0745Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002698Metagenome / Metatranscriptome536Y

Sequences

Protein IDFamilyRBSSequence
M2t2BS2_103716631F002698N/AMKLQIDRIDQHALTEFINRVKLIDSFIYMKIKDGQIQSTVYLPQRDAVKHHSIQADTIFQVSEWPDTDKEMKIAFFEGNRVIEAIKHFEHDAIKGELEFIENDEEFVASTLRIFNDELEITLSCSEPSLGFKDLSQEQRDAIFARTDSQFDFKLDTHSIGKVKNLFSLDKDETFGIKSDVAGINVNGKSFNVVLTPDTNGSGKVTVYKKYLNLLDKEEQTVYVSDSKVVFESNDSHTLLTISTCQTA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.