Basic Information | |
---|---|
Taxon OID | 3300002141 Open in IMG/M |
Scaffold ID | M3t6BS1_1842354 Open in IMG/M |
Source Dataset Name | M3t6BS1 (103f) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 614 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltic Sea | |||||||
Coordinates | Lat. (o) | 65.3915 | Long. (o) | 23.49916667 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008421 | Metagenome | 333 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
M3t6BS1_18423541 | F008421 | N/A | MKKKLMVAGCSFSAPTKDNNGTSWSELLAERLGWDLVNLARQGCSNGGIRLQIEEIRKQKPDFAIITPTFWDRMEIPANSAPYDWTQGVSKGPNPPLEKHLQDRTRGNGYRKEDGIKNVNYGKEPSNMICETIFTLAENFDHPYRMARISKDA |
⦗Top⦘ |