Scaffold M3t6FKB1_1558193

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold M3t6FKB1_1558193

Scaffold M3t6FKB1_1558193

Overview

Basic Information
Taxon OID	3300002138 Open in IMG/M
Scaffold ID	M3t6FKB1_1558193 Open in IMG/M
Source Dataset Name	M3t6FKB1 (102f)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	60127
Total Scaffold Genes	87 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	65 (74.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	65.3915	Long. (^o)	23.49916667	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006112	Metagenome / Metatranscriptome	381	Y

Sequences

Protein ID	Family	RBS	Sequence
M3t6FKB1_15581933	F006112	GGA	MNYTMYIYKTDRRRKNGERLFSTTVWKDRDEASMQREVNELHLHHYPRTSFRMEFCPTMKTVKNLMSGQDIEIPHDTPRCCDPSTEIYWST*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.