Scaffold M2t6BS2_1204498

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold M2t6BS2_1204498

Scaffold M2t6BS2_1204498

Overview

Basic Information
Taxon OID	3300002132 Open in IMG/M
Scaffold ID	M2t6BS2_1204498 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t6BS2 (105f)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1114
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	57.305	Long. (^o)	20.0745	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073283	Metagenome / Metatranscriptome	120	N

Sequences

Protein ID	Family	RBS	Sequence
M2t6BS2_12044981	F073283	GGAGG	VTTLTKMQVDTLEYSFAHLNVDFEEVPSAKMHGTMEGVQQQLDSGSNKVIYSYRNKTGGVTITSMKVGEETEESKEALNTVRENVMKYWKDLHEFRKKDDTTKNKLMDVNMVEGDL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.