Scaffold C687J26621_10239172

Overview

Basic Information

• Taxon OID: 3300002104
• Scaffold ID: C687J26621_10239172
• Source Dataset Name: Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 531
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location

• Location Name: Rifle, Colorado, United States
• Coordinates
  • Lat. (^o): 39.53
  • Long. (^o): -107.78

Associated Families

Family	Category	Number of Sequences	3D Structure?
F086760	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
C687J26621_102391721	F086760	N/A	QRASVGKEEMEQALADLQAQGVVMIRDNFCADPHLAGVDLRVVALVESIDGADPQLSAIRLIDDAWNKWLGEYLSNHRCG*