Scaffold JGI24218J26658_1040801

Overview

Basic Information

• Taxon OID: 3300002092
• Scaffold ID: JGI24218J26658_1040801
• Source Dataset Name: Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 535
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany

Source Dataset Sampling Location

• Location Name: Brandenburg, Germany
• Coordinates
  • Lat. (^o): 53.152741
  • Long. (^o): 13.022518

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025685	Metagenome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24218J26658_10408013	F025685	GGCGG	MRYIADLFALVGLVCTIVVAGFYMGYTTYQPKCGNMLAVFTKECK*