Scaffold JGI24750J21931_1001525

Overview

Basic Information

• Taxon OID: 3300002070
• Scaffold ID: JGI24750J21931_1001525
• Source Dataset Name: Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2854
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: Kellogg Biological Station, Michigan, USA
• Coordinates
  • Lat. (^o): 42.3948
  • Long. (^o): -85.3738

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000694	Metagenome / Metatranscriptome	932	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24750J21931_10015254	F000694	GGAG	MRKGRISVAGASILFALGLAAWEVYFFWYAGSFPELAGRVGLFTPDRXGFNMAWLAALYLTYQLISIPFSLPSAGNRFIGVVDGMASLVPLAVVLIVVFGKPQLVGTTERWEAACLLIFITIVDLFGGYTFNLALSRRTMDVSPASPG*