Scaffold JGIcombinedJ21912_10050419

Overview

Basic Information

• Taxon OID: 3300002069
• Scaffold ID: JGIcombinedJ21912_10050419
• Source Dataset Name: Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1832
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location

• Location Name: Barrow Environmental Observatory site, Barrow, Alaska, USA
• Coordinates
  • Lat. (^o): 71.29055
  • Long. (^o): -156.788643

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077101	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
JGIcombinedJ21912_100504192	F077101	GGA	MTQNLSTVYQIRKTGSGQFLPPGQIYLSPGFAKIAPWCLARRDSFSAKAPGLMVGVTAPPTLTAPTRCR*