NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SMTZ23_10034200

Scaffold SMTZ23_10034200


Overview

Basic Information
Taxon OID3300002053 Open in IMG/M
Scaffold IDSMTZ23_10034200 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZ
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8070
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.6478111Long. (o)-77.1112083Alt. (m)Depth (m).24 to .32
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075043Metagenome / Metatranscriptome119Y
F092306Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
SMTZ23_1003420010F075043GGAGGMRRILTALMDTRKGTLADQGASSQRLQECEDLFRCMDRELDGIDGVDTTLRETMVTGDFTYALLEYVKRDFLGAYQQQTFAFEPLVFNDILPNYLPASRYLKQAGLDDLEYVGEKGQARPGYVYDATKRQWQVYPWKKQFDFSHQALVNDDIGYFSDQIELMARSARRTLEKFVSRMYTNAVSIGVLTTAGALYSTTGRLTTARISEARMAFNQRLDLRGERILSPLRYIVYHTGLADTVAQIQASMLVPELATNAANVIRGTFTAIEDPYITGTAPNLPWFAFAAPAQIKTLVLARMKGWTGPKIVRKRSDIEAVTSIGGPGAPVDPLLGDFETGNIVLMVWDVWGTYVGGAGYGNLVDHRGAYYSSGTQQ*
SMTZ23_1003420011F092306AGGAGGMAYTTFYPGPGWQQSSEPMTIVDVQESDLWPVGARSLSGAKDTISNGEHPVVAIGGRTAADGRPLNVTGVVVSIALTTAGTATDRVEVDIADGKIVRQYVSNIKSYSGGSAYAFETAPVVGQPVYVDDSADLSAGVTLSMSPFNSTGTLKNPMAGILFYCQTEIADGQAGGGRESTTFDGSLPDEETEQVYCVLLINNSRDLS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.