Basic Information | |
---|---|
Taxon OID | 3300002053 Open in IMG/M |
Scaffold ID | SMTZ23_10001498 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZ |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 36518 |
Total Scaffold Genes | 32 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 29 (90.62%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | White Oak River estuary, North Carolina, USA | |||||||
Coordinates | Lat. (o) | 34.6478111 | Long. (o) | -77.1112083 | Alt. (m) | Depth (m) | .24 to .32 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038478 | Metagenome / Metatranscriptome | 166 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SMTZ23_1000149832 | F038478 | N/A | MLGEGKTGGVVAKGILKERPSNEKLQETHSDFAVELIGFDFGPNHIQIQSTIANKLLEIDEEGATKAFEVLCRSFSEVCHEHHIKFDPVDLFILVDDGLSRGTSTKFRDANDGSLFAEILIPAKDFRVHEYWKYTFLHELGHSWFSIRFSSKDMKFGYEDFLIDLVAICTFRKILPPHKRVYREVRKHRTFFLTQQTKRFLGKELYRQILTDPETYLRDLRQRV* |
⦗Top⦘ |