Scaffold MIS_10020308

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold MIS_10020308

Scaffold MIS_10020308

Overview

Basic Information
Taxon OID	3300002027 Open in IMG/M
Scaffold ID	MIS_10020308 Open in IMG/M
Source Dataset Name	Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3604
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (18.18%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us

Source Dataset Sampling Location
Location Name	Middle Island Sinkhole, Lake Huron Michigan, USA
Coordinates	Lat. (^o)	45.19843	Long. (^o)	-83.32721	Alt. (m)		Depth (m)	23
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011397	Metagenome / Metatranscriptome	291	Y

Sequences

Protein ID	Family	RBS	Sequence
MIS_100203087	F011397	N/A	MKDFELLKRTYPVSEFDRNCDGYDYIVKNSTEDERLECGINLNDLQRVIKAGEKYIYQVAKEGKEFKIMCLCFNNYAIIRKHIFKLDDD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.